Lineage for d1jxgb_ (1jxg B:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (4 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) 
Protein Plastocyanin [49507] (14 species) Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (9 PDB entries) 
Domain d1jxgb_: 1jxg B: [67414]
Details for d1jxgb_
PDB Entry: 1jxg (more details), 1.6 Å
PDB Description: the 1.6 a resolution crystal structure of a mutant poplar plastocyanin bearing a 21-25 engeneered disulfide bridge
SCOP Domain Sequences for d1jxgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jxgb_ b.6.1.1 (B:) Plastocyanin {Poplar (Populus nigra), variant italica}
midvllgaddgslafvpsefscspgckivfknnagfphnivfdedsipsgvdaskismse
edllnakgetfevalsnkgeysfycsphqgagmvgkvtvn
SCOP Domain Coordinates for d1jxgb_:
Click to download the PDB-style file with coordinates for d1jxgb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jxgb_:
- d1jxgb_ is new in SCOP 1.59
- d1jxgb_ appears in SCOP 1.61
- d1jxgb_ appears in the current release, SCOPe 2.08
View in 3D
