Lineage for d1jxab2 (1jxa B:1-240)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138489Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 138490Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 138491Family d.153.1.1: Class II glutamine amidotransferases [56236] (5 proteins)
  6. 138506Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)
  7. 138507Species Escherichia coli [TaxId:562] [56238] (3 PDB entries)
  8. 138517Domain d1jxab2: 1jxa B:1-240 [67410]
    Other proteins in same PDB: d1jxaa1, d1jxab1, d1jxac1

Details for d1jxab2

PDB Entry: 1jxa (more details), 3.1 Å

PDB Description: glucosamine 6-phosphate synthase with glucose 6-phosphate

SCOP Domain Sequences for d1jxab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxab2 d.153.1.1 (B:1-240) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy

SCOP Domain Coordinates for d1jxab2:

Click to download the PDB-style file with coordinates for d1jxab2.
(The format of our PDB-style files is described here.)

Timeline for d1jxab2: