SCOPe 2.05: Domain d1jxab1: 1jxa B:241-608

Lineage for d1jxab1 (1jxa B:241-608)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.1: double-SIS domain [53698] (5 proteins)
   duplication: consists of two SIS domains related by pseudo dyad

6. Protein "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) [53699] (1 species)

7. Species Escherichia coli [TaxId:562] [53700] (5 PDB entries)

8. Domain d1jxab1: 1jxa B:241-608 [67409]
   Other proteins in same PDB: d1jxaa2, d1jxab2, d1jxac2
   complexed with g6q

Details for d1jxab1

PDB Entry: 1jxa, 3.1 Å

PDB Description: glucosamine 6-phosphate synthase with glucose 6-phosphate

PDB Compounds: (B:) glucosamine 6-phosphate synthase

SCOPe Domain Sequences for d1jxab1:

Sequence; same for both SEQRES and ATOM records:

>d1jxab1 c.80.1.1 (B:241-608) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]}
dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
klkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
laksvtve

Timeline for d1jxab1:

• d1jxab1 first appeared in SCOP 1.59
  
• d1jxab1 appears in SCOPe 2.04
  
• d1jxab1 appears in SCOPe 2.06
  
• d1jxab1 appears in the current release, SCOPe 2.08