SCOPe 2.02: Domain d1jx6a_: 1jx6 A:

Lineage for d1jx6a_ (1jx6 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)

6. Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species)

7. Species Vibrio harveyi [TaxId:669] [69623] (3 PDB entries)

8. Domain d1jx6a_: 1jx6 A: [67406]
   complexed with ai2, ca

Details for d1jx6a_

PDB Entry: 1jx6, 1.5 Å

PDB Description: crystal structure of luxp from vibrio harveyi complexed with autoinducer-2

PDB Compounds: (A:) luxp protein

SCOPe Domain Sequences for d1jx6a_:

Sequence; same for both SEQRES and ATOM records:

>d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]}
gywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrni
asfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfveh
vldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyf
segyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacst
dvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwd
ledkpvptvysgdfeivtkadsperiealkkrafrysd

Timeline for d1jx6a_:

• d1jx6a_ first appeared in SCOP 1.59
  
• d1jx6a_ appears in SCOPe 2.01
  
• d1jx6a_ appears in SCOPe 2.03
  
• d1jx6a_ appears in the current release, SCOPe 2.08