Lineage for d1jx2a1 (1jx2 A:36-79)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109530Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 109531Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 109532Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 109554Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50089] (18 PDB entries)
  8. 109566Domain d1jx2a1: 1jx2 A:36-79 [67402]
    Other proteins in same PDB: d1jx2a2, d1jx2b_

Details for d1jx2a1

PDB Entry: 1jx2 (more details), 2.3 Å

PDB Description: crystal structure of the nucleotide-free dynamin a gtpase domain, determined as myosin fusion

SCOP Domain Sequences for d1jx2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jx2a1 b.34.3.1 (A:36-79) Myosin S1 fragment, N-terminal domain {Slime mold (Dictyostelium discoideum)}
fkltvsdkryiwynpdpkerdsyecgeivsetsdsftfktvdgq

SCOP Domain Coordinates for d1jx2a1:

Click to download the PDB-style file with coordinates for d1jx2a1.
(The format of our PDB-style files is described here.)

Timeline for d1jx2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jx2a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1jx2b_