Lineage for d1jwyb_ (1jwy B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110381Protein Dynamin G domain [69488] (2 species)
    the family common core is decorated with large insertions
  7. 2110384Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [69489] (2 PDB entries)
  8. 2110385Domain d1jwyb_: 1jwy B: [67401]
    Other proteins in same PDB: d1jwya1, d1jwya2, d1jwya3
    complexed with adp, bgc, gdp, mg

Details for d1jwyb_

PDB Entry: 1jwy (more details), 2.3 Å

PDB Description: crystal structure of the dynamin a gtpase domain complexed with gdp, determined as myosin fusion
PDB Compounds: (B:) Dynamin A GTPase domain

SCOPe Domain Sequences for d1jwyb_:

Sequence, based on SEQRES records: (download)

>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
dqlipvinklqdvfntlgsdpldlpqivvvgsqssgkssvlenivgrdflprgsgivtrr
plilqlthlpiaddgsqtqewgeflhkpndmfydfseireeiirdtdrmtgknkgisaqp
inlkiysphvvnltlvdlpgitkvpvgdqptdieqqirrmvmayikkqnaiivavtpant
dlansdalqlakevdpegkrtigvitkldlmdkgtdamevltgrvipltlgfigvinrsq
ediiakksireslkseilyfknhpiyksianrsgtaylsktlnkllmfhirdtlpdlkvk
vskmls

Sequence, based on observed residues (ATOM records): (download)

>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
dqlipvinklqdvfntlgsdpldlpqivvvgsqssgkssvlenivgrdflprplilqlth
lpiaddgsqtqewgeflhkpndmfydfseireeiirdtdisaqpinlkiysphvvnltlv
dlpgitdieqqirrmvmayikkqnaiivavtpantdlansdalqlakevdpegkrtigvi
tkldlmdkgtdamevltgrvipltlgfigvinrsqediiakksireslkseilyfknhpi
yksianrsgtaylsktlnkllmfhirdtlpdlkvkvskmls

SCOPe Domain Coordinates for d1jwyb_:

Click to download the PDB-style file with coordinates for d1jwyb_.
(The format of our PDB-style files is described here.)

Timeline for d1jwyb_: