Lineage for d1jwya2 (1jwy A:13-30,A:80-776)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1847377Family c.37.1.9: Motor proteins [52641] (5 proteins)
  6. 1847461Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. 1847494Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [52645] (18 PDB entries)
  8. 1847505Domain d1jwya2: 1jwy A:13-30,A:80-776 [67400]
    Other proteins in same PDB: d1jwya1, d1jwyb_
    complexed with adp, bgc, gdp, mg

Details for d1jwya2

PDB Entry: 1jwy (more details), 2.3 Å

PDB Description: crystal structure of the dynamin a gtpase domain complexed with gdp, determined as myosin fusion
PDB Compounds: (A:) myosin II heavy chain

SCOPe Domain Sequences for d1jwya2:

Sequence, based on SEQRES records: (download)

>d1jwya2 c.37.1.9 (A:13-30,A:80-776) Myosin S1, motor domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
dpihdrtsdyhkylkvkqXdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvr
ynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmldd
rqnqsllitgesgagktentkkviqylasvagrnqangsgvleqqilqanpileafgnak
ttrnnnssrfgkfieiqfnsagfisgasiqsylleksrvvfqseternyhifyqllagat
aeekkalhlagpesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiia
gilhlgnikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhl
nvekssssrdalvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeql
cinytneklqqffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilall
deqsvfpnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknk
dplqqdlelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettn
phfvrciipnnkqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryylla
pnvprdaedsqkatdavlkhlnidpeqyrfgitkiffragqlarieeareqrisei

Sequence, based on observed residues (ATOM records): (download)

>d1jwya2 c.37.1.9 (A:13-30,A:80-776) Myosin S1, motor domain {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
dpihdrtsdyhkylkvkqXdrqvkkddanqrnpikfdgvedmselsylnepavfhnlrvr
ynqdliytysglflvavnpfkripiytqemvdifkgrrrnevaphifaisdvayrsmldd
rqnqsllitgesgagktentkkviqylasvagsgvleqqilqanpileafgnakttrnnn
ssrfgkfieiqfnsagfisgasiqsylleksrvvfqseternyhifyqllagataeekka
lhlagpesfnylnqsgcvdikgvsdseefkitrqamdivgfsqeeqmsifkiiagilhlg
nikfekgagegavlkdktalnaastvfgvnpsvlekalmeprilagrdlvaqhlnvekss
ssrdalvkalygrlflwlvkkinnvlcqerkayfigvldisgfeifkvnsfeqlcinytn
eklqqffnhhmfkleqeeylkekinwtfidfgldsqatidlidgrqppgilalldeqsvf
pnatdntlitklhshfskknakyeeprfsktefgvthyagqvmyeiqdwleknkdplqqd
lelcfkdssdnvvtklfndpniasrakkganfitvaaqykeqlaslmatlettnphfvrc
iipnnkqlpakledkvvldqlrcngvlegiritrkgfpnriiyadfvkryyllapnvprd
aedsqkatdavlkhlnidpeqyrfgitkiffragqlarieeareqrisei

SCOPe Domain Coordinates for d1jwya2:

Click to download the PDB-style file with coordinates for d1jwya2.
(The format of our PDB-style files is described here.)

Timeline for d1jwya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jwya1
View in 3D
Domains from other chains:
(mouse over for more information)
d1jwyb_