Lineage for d1jwta_ (1jwt A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111670Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)
  6. 111959Protein Thrombin [50531] (2 species)
  7. 111995Species Human (Homo sapiens) [TaxId:9606] [50532] (126 PDB entries)
  8. 112108Domain d1jwta_: 1jwt A: [67398]

Details for d1jwta_

PDB Entry: 1jwt (more details), 2.5 Å

PDB Description: crystal structure of thrombin in complex with a novel bicyclic lactam inhibitor

SCOP Domain Sequences for d1jwta_:

Sequence, based on SEQRES records: (download)

>d1jwta_ b.47.1.2 (A:) Thrombin {Human (Homo sapiens)}
tfgsgeadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspq
ellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismleki
yihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnl
ketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegd
sggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfgedfeei
peeyl

Sequence, based on observed residues (ATOM records): (download)

>d1jwta_ b.47.1.2 (A:) Thrombin {Human (Homo sapiens)}
tfgsgeadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspq
ellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismleki
yihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnl
ketwgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfv
mkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfgedfeeipeeyl

SCOP Domain Coordinates for d1jwta_:

Click to download the PDB-style file with coordinates for d1jwta_.
(The format of our PDB-style files is described here.)

Timeline for d1jwta_: