SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1jwnc_ (1jwn C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1976664Protein Hemoglobin I [46464] (2 species)
  7. 1976665Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (37 PDB entries)
  8. 1976746Domain d1jwnc_: 1jwn C: [67396]
    complexed with cmo, hem; mutant

Details for d1jwnc_

PDB Entry: 1jwn (more details), 2.1 Å

PDB Description: Crystal Structure of Scapharca inaequivalvis HbI, I114F Mutant Ligated to Carbon Monoxide.
PDB Compounds: (C:) Globin I - Ark Shell

SCOPe Domain Sequences for d1jwnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwnc_ a.1.1.2 (C:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkfngpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d1jwnc_:

Click to download the PDB-style file with coordinates for d1jwnc_.
(The format of our PDB-style files is described here.)

Timeline for d1jwnc_: