SCOPe 2.05: Domain d1jwna_: 1jwn A:

Lineage for d1jwna_ (1jwn A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (36 PDB entries)

8. Domain d1jwna_: 1jwn A: [67394]
   complexed with cmo, hem; mutant

Details for d1jwna_

PDB Entry: 1jwn, 2.1 Å

PDB Description: crystal structure of scapharca inaequivalvis hbi, i114f mutant ligated to carbon monoxide.

PDB Compounds: (A:) Globin I - Ark Shell

SCOPe Domain Sequences for d1jwna_:

Sequence; same for both SEQRES and ATOM records:

>d1jwna_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkfngpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d1jwna_:

• d1jwna_ first appeared in SCOP 1.59
  
• d1jwna_ appears in SCOPe 2.04
  
• d1jwna_ appears in SCOPe 2.06
  
• d1jwna_ appears in the current release, SCOPe 2.08