![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
![]() | Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [53838] (11 PDB entries) |
![]() | Domain d1jwlc_: 1jwl C: [67393] Other proteins in same PDB: d1jwla1, d1jwlb1 protein/DNA complex; complexed with npf |
PDB Entry: 1jwl (more details), 4 Å
SCOPe Domain Sequences for d1jwlc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwlc_ c.93.1.1 (C:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv drllqlsqgqavkgnqllpvslvkrkttl
Timeline for d1jwlc_:
![]() Domains from other chains: (mouse over for more information) d1jwla1, d1jwla2, d1jwlb1, d1jwlb2 |