SCOPe 2.05: Domain d1jwlc_: 1jwl C:

Lineage for d1jwlc_ (1jwl C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)

7. Species Escherichia coli [TaxId:562] [53838] (11 PDB entries)

8. Domain d1jwlc_: 1jwl C: [67393]
   Other proteins in same PDB: d1jwla1, d1jwlb1
   protein/DNA complex; complexed with npf

Details for d1jwlc_

PDB Entry: 1jwl, 4 Å

PDB Description: structure of the dimeric lac repressor/operator o1/onpf complex

PDB Compounds: (C:) lactose operon repressor

SCOPe Domain Sequences for d1jwlc_:

Sequence; same for both SEQRES and ATOM records:

>d1jwlc_ c.93.1.1 (C:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttl

Timeline for d1jwlc_:

• d1jwlc_ first appeared in SCOP 1.59, called d1jwlc1
  
• d1jwlc_ appears in SCOPe 2.04
  
• d1jwlc_ appears in SCOPe 2.06
  
• d1jwlc_ appears in the current release, SCOPe 2.08