Lineage for d1jwlb1 (1jwl B:2-60)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152229Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 152230Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 152326Family a.35.1.5: Bacterial repressors [47438] (3 proteins)
  6. 152331Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 152332Species Escherichia coli [TaxId:562] [47442] (8 PDB entries)
  8. 152340Domain d1jwlb1: 1jwl B:2-60 [67391]
    Other proteins in same PDB: d1jwla2, d1jwlb2, d1jwlc1

Details for d1jwlb1

PDB Entry: 1jwl (more details), 4 Å

PDB Description: structure of the dimeric lac repressor/operator o1/onpf complex

SCOP Domain Sequences for d1jwlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwlb1 a.35.1.5 (B:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli}
kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq

SCOP Domain Coordinates for d1jwlb1:

Click to download the PDB-style file with coordinates for d1jwlb1.
(The format of our PDB-style files is described here.)

Timeline for d1jwlb1: