SCOP 1.63: Domain d1jwla1: 1jwl A:2-60

Lineage for d1jwla1 (1jwl A:2-60)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (3 proteins)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)

7. Species Escherichia coli [TaxId:562] [47442] (8 PDB entries)

8. Domain d1jwla1: 1jwl A:2-60 [67389]
   Other proteins in same PDB: d1jwla2, d1jwlb2, d1jwlc_

Details for d1jwla1

PDB Entry: 1jwl, 4 Å

PDB Description: structure of the dimeric lac repressor/operator o1/onpf complex

SCOP Domain Sequences for d1jwla1:

Sequence; same for both SEQRES and ATOM records:

>d1jwla1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli}
kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq

Timeline for d1jwla1:

• d1jwla1 first appeared in SCOP 1.59
  
• d1jwla1 appears in SCOP 1.61
  
• d1jwla1 appears in SCOP 1.65
  
• d1jwla1 appears in the current release, SCOPe 2.08