Lineage for d1jwib_ (1jwi B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614335Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 614336Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 614337Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
    Pfam 00059
  6. 614604Protein Snake coagglutinin beta chain [88867] (9 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 614618Species Puff adder (Bitis arientans), bitiscetin [88872] (2 PDB entries)
  8. 614619Domain d1jwib_: 1jwi B: [67384]
    Other proteins in same PDB: d1jwia_

Details for d1jwib_

PDB Entry: 1jwi (more details), 2 Å

PDB Description: Crystal Structure of Bitiscetin, a von Willeband Factor-dependent Platelet Aggregation Inducer.

SCOP Domain Sequences for d1jwib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwib_ d.169.1.1 (B:) Snake coagglutinin beta chain {Puff adder (Bitis arientans), bitiscetin}
gclpdwssykghcykvfkvektwadaekfckelvngghlmsvnsreegefisklalekmr
ivlvwiglshfwricplrwtdgarldyralsdepicfvaesfhnkwiqwtcnrkksfvck
yrv

SCOP Domain Coordinates for d1jwib_:

Click to download the PDB-style file with coordinates for d1jwib_.
(The format of our PDB-style files is described here.)

Timeline for d1jwib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jwia_