Lineage for d1jwib_ (1jwi B:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily) Superfamily d.169.1: C-type lectin-like [56436] (6 families) 
Family d.169.1.1: C-type lectin domain [56437] (18 proteins) 
Protein Snake coagglutinin [56446] (5 species) 
Species Puff adder (Bitis arientans), bitiscetin [69854] (1 PDB entry) 
Domain d1jwib_: 1jwi B: [67384]
Details for d1jwib_
PDB Entry: 1jwi (more details), 2 Å
PDB Description: Crystal Structure of Bitiscetin, a von Willeband Factor-dependent Platelet Aggregation Inducer.
SCOP Domain Sequences for d1jwib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwib_ d.169.1.1 (B:) Snake coagglutinin {Puff adder (Bitis arientans), bitiscetin}
gclpdwssykghcykvfkvektwadaekfckelvngghlmsvnsreegefisklalekmr
ivlvwiglshfwricplrwtdgarldyralsdepicfvaesfhnkwiqwtcnrkksfvck
yrv
SCOP Domain Coordinates for d1jwib_:
Click to download the PDB-style file with coordinates for d1jwib_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jwib_:
- d1jwib_ first appeared in SCOP 1.59
- d1jwib_ appears in SCOP 1.63
- d1jwib_ appears in the current release, SCOPe 2.08
View in 3D
