| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.3: MoaD/ThiS [54285] (5 families) ![]() possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies |
| Family d.15.3.1: MoaD [54286] (2 proteins) automatically mapped to Pfam PF02597 |
| Protein Molybdopterin synthase subunit MoaD [54287] (2 species) |
| Species Escherichia coli [TaxId:562] [54288] (7 PDB entries) |
| Domain d1jwbd_: 1jwb D: [67382] Other proteins in same PDB: d1jwbb_ complexed with MoeB complexed with amp, so4, zn |
PDB Entry: 1jwb (more details), 2.1 Å
SCOPe Domain Sequences for d1jwbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwbd_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli [TaxId: 562]}
ikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlvs
fdhpltdgdevaffppvtgg
Timeline for d1jwbd_: