SCOPe 2.07: Domain d1jwbd_: 1jwb D:

Lineage for d1jwbd_ (1jwb D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.3: MoaD/ThiS [54285] (5 families)
   possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.3.1: MoaD [54286] (2 proteins)
   automatically mapped to Pfam PF02597

6. Protein Molybdopterin synthase subunit MoaD [54287] (2 species)

7. Species Escherichia coli [TaxId:562] [54288] (7 PDB entries)

8. Domain d1jwbd_: 1jwb D: [67382]
   Other proteins in same PDB: d1jwbb_
   complexed with MoeB
   complexed with amp, so4, zn

Details for d1jwbd_

PDB Entry: 1jwb, 2.1 Å

PDB Description: structure of the covalent acyl-adenylate form of the moeb-moad protein complex

PDB Compounds: (D:) molybdopterin [mpt] converting factor, subunit 1

SCOPe Domain Sequences for d1jwbd_:

Sequence; same for both SEQRES and ATOM records:

>d1jwbd_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli [TaxId: 562]}
ikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlvs
fdhpltdgdevaffppvtgg

Timeline for d1jwbd_:

• d1jwbd_ first appeared in SCOP 1.59
  
• d1jwbd_ appears in SCOPe 2.06
  
• d1jwbd_ appears in the current release, SCOPe 2.08