SCOP 1.61: Domain d1jwbd_: 1jwb D:

Lineage for d1jwbd_ (1jwb D:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.3: MoaD/ThiS [54285] (2 families)

5. Family d.15.3.1: MoaD [54286] (1 protein)

6. Protein Molybdopterin synthase subunit MoaD [54287] (1 species)

7. Species Escherichia coli [TaxId:562] [54288] (5 PDB entries)

8. Domain d1jwbd_: 1jwb D: [67382]
   Other proteins in same PDB: d1jwbb_

Details for d1jwbd_

PDB Entry: 1jwb, 2.1 Å

PDB Description: structure of the covalent acyl-adenylate form of the moeb-moad protein complex

SCOP Domain Sequences for d1jwbd_:

Sequence; same for both SEQRES and ATOM records:

>d1jwbd_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli}
ikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlvs
fdhpltdgdevaffppvtgg

Timeline for d1jwbd_:

• d1jwbd_ first appeared in SCOP 1.59
  
• d1jwbd_ appears in SCOP 1.63
  
• d1jwbd_ appears in the current release, SCOPe 2.08