| Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
Superfamily d.15.3: MoaD/ThiS [54285] (2 families) ![]() |
| Family d.15.3.1: MoaD [54286] (1 protein) |
| Protein Molybdopterin synthase subunit MoaD [54287] (1 species) |
| Species Escherichia coli [TaxId:562] [54288] (5 PDB entries) |
| Domain d1jwbd_: 1jwb D: [67382] Other proteins in same PDB: d1jwbb_ |
PDB Entry: 1jwb (more details), 2.1 Å
SCOP Domain Sequences for d1jwbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwbd_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli}
ikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlvs
fdhpltdgdevaffppvtgg
Timeline for d1jwbd_: