SCOP 1.71: Domain d1jwad_: 1jwa D:

Lineage for d1jwad_ (1jwa D:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.3: MoaD/ThiS [54285] (3 families)
   possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.3.1: MoaD [54286] (2 proteins)

6. Protein Molybdopterin synthase subunit MoaD [54287] (2 species)

7. Species Escherichia coli [TaxId:562] [54288] (6 PDB entries)

8. Domain d1jwad_: 1jwa D: [67380]
   Other proteins in same PDB: d1jwab_
   complexed with MoeB
   complexed with atp

Details for d1jwad_

PDB Entry: 1jwa, 2.9 Å

PDB Description: structure of the atp-bound moeb-moad protein complex

SCOP Domain Sequences for d1jwad_:

Sequence; same for both SEQRES and ATOM records:

>d1jwad_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli}
mikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlv
sfdhpltdgdevaffppvtgg

Timeline for d1jwad_:

• d1jwad_ first appeared in SCOP 1.59
  
• d1jwad_ appears in SCOP 1.69
  
• d1jwad_ appears in SCOP 1.73
  
• d1jwad_ appears in the current release, SCOPe 2.08