Lineage for d1jwad_ (1jwa D:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.3: MoaD/ThiS [54285] (2 families) 
Family d.15.3.1: MoaD [54286] (1 protein) Protein Molybdopterin synthase subunit MoaD [54287] (1 species) Species Escherichia coli [TaxId:562] [54288] (5 PDB entries) 
Domain d1jwad_: 1jwa D: [67380]
Other proteins in same PDB: d1jwab_
Details for d1jwad_
PDB Entry: 1jwa (more details), 2.9 Å
PDB Description: structure of the atp-bound moeb-moad protein complex
SCOP Domain Sequences for d1jwad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwad_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli}
mikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlv
sfdhpltdgdevaffppvtgg
SCOP Domain Coordinates for d1jwad_:
Click to download the PDB-style file with coordinates for d1jwad_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jwad_:
- d1jwad_ is new in SCOP 1.59
- d1jwad_ appears in SCOP 1.61
- d1jwad_ appears in the current release, SCOPe 2.08
View in 3D
