SCOPe 2.07: Domain d1jwab_: 1jwa B:

Lineage for d1jwab_ (1jwa B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest

4. Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families)
   transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
   the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds

5. Family c.111.1.1: Molybdenum cofactor biosynthesis protein MoeB [69573] (1 protein)

6. Protein Molybdenum cofactor biosynthesis protein MoeB [69574] (1 species)

7. Species Escherichia coli [TaxId:562] [69575] (3 PDB entries)

8. Domain d1jwab_: 1jwa B: [67379]
   Other proteins in same PDB: d1jwad_
   complexed with atp

Details for d1jwab_

PDB Entry: 1jwa, 2.9 Å

PDB Description: structure of the atp-bound moeb-moad protein complex

PDB Compounds: (B:) molybdopterin biosynthesis moeb protein

SCOPe Domain Sequences for d1jwab_:

Sequence, based on SEQRES records:

>d1jwab_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]}
aelsdqemlrynrqiilrgfdfdgqealkdsrvlivglgglgcaasqylasagvgnltll
dfdtvslsnlqrqtlhsdatvgqpkvesardaltrinphiaitpvnallddaelaaliae
hdlvldctdnvavrnqlnagcfaakvplvsgaairmegqitvftyqdgepcyrclsrlfg
enaltcveagvmapligvigslqameaikmlagygkpasgkivmydamtcqfremklmr

Sequence, based on observed residues (ATOM records):

>d1jwab_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]}
aelsdqemlrynrqiilrgfdfdgqealkdsrvlivglgglgcaasqylasagvgnltll
dfdtvslsnlqrqtlhsdatvgqpkvesardaltrinphiaitpvnallddaelaaliae
hdlvldctdnvavrnqlnagcfaakvplvsgaairmegqitvftyeagvmapligvigsl
qameaikmlagygkpasgkivmydamtcqfremklmr

Timeline for d1jwab_:

• d1jwab_ first appeared in SCOP 1.59
  
• d1jwab_ appears in SCOPe 2.06
  
• d1jwab_ appears in the current release, SCOPe 2.08