Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest |
Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds |
Family c.111.1.1: Molybdenum cofactor biosynthesis protein MoeB [69573] (1 protein) |
Protein Molybdenum cofactor biosynthesis protein MoeB [69574] (1 species) |
Species Escherichia coli [TaxId:562] [69575] (3 PDB entries) |
Domain d1jwab_: 1jwa B: [67379] Other proteins in same PDB: d1jwad_ complexed with atp |
PDB Entry: 1jwa (more details), 2.9 Å
SCOPe Domain Sequences for d1jwab_:
Sequence, based on SEQRES records: (download)
>d1jwab_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} aelsdqemlrynrqiilrgfdfdgqealkdsrvlivglgglgcaasqylasagvgnltll dfdtvslsnlqrqtlhsdatvgqpkvesardaltrinphiaitpvnallddaelaaliae hdlvldctdnvavrnqlnagcfaakvplvsgaairmegqitvftyqdgepcyrclsrlfg enaltcveagvmapligvigslqameaikmlagygkpasgkivmydamtcqfremklmr
>d1jwab_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} aelsdqemlrynrqiilrgfdfdgqealkdsrvlivglgglgcaasqylasagvgnltll dfdtvslsnlqrqtlhsdatvgqpkvesardaltrinphiaitpvnallddaelaaliae hdlvldctdnvavrnqlnagcfaakvplvsgaairmegqitvftyeagvmapligvigsl qameaikmlagygkpasgkivmydamtcqfremklmr
Timeline for d1jwab_: