Lineage for d1jwab_ (1jwa B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149982Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 2149983Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 2149984Family c.111.1.1: Molybdenum cofactor biosynthesis protein MoeB [69573] (1 protein)
  6. 2149985Protein Molybdenum cofactor biosynthesis protein MoeB [69574] (1 species)
  7. 2149986Species Escherichia coli [TaxId:562] [69575] (3 PDB entries)
  8. 2149989Domain d1jwab_: 1jwa B: [67379]
    Other proteins in same PDB: d1jwad_
    complexed with atp

Details for d1jwab_

PDB Entry: 1jwa (more details), 2.9 Å

PDB Description: structure of the atp-bound moeb-moad protein complex
PDB Compounds: (B:) molybdopterin biosynthesis moeb protein

SCOPe Domain Sequences for d1jwab_:

Sequence, based on SEQRES records: (download)

>d1jwab_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]}
aelsdqemlrynrqiilrgfdfdgqealkdsrvlivglgglgcaasqylasagvgnltll
dfdtvslsnlqrqtlhsdatvgqpkvesardaltrinphiaitpvnallddaelaaliae
hdlvldctdnvavrnqlnagcfaakvplvsgaairmegqitvftyqdgepcyrclsrlfg
enaltcveagvmapligvigslqameaikmlagygkpasgkivmydamtcqfremklmr

Sequence, based on observed residues (ATOM records): (download)

>d1jwab_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]}
aelsdqemlrynrqiilrgfdfdgqealkdsrvlivglgglgcaasqylasagvgnltll
dfdtvslsnlqrqtlhsdatvgqpkvesardaltrinphiaitpvnallddaelaaliae
hdlvldctdnvavrnqlnagcfaakvplvsgaairmegqitvftyeagvmapligvigsl
qameaikmlagygkpasgkivmydamtcqfremklmr

SCOPe Domain Coordinates for d1jwab_:

Click to download the PDB-style file with coordinates for d1jwab_.
(The format of our PDB-style files is described here.)

Timeline for d1jwab_: