Lineage for d1jw9d_ (1jw9 D:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.3: MoaD/ThiS [54285] (2 families) 
Family d.15.3.1: MoaD [54286] (1 protein) Protein Molybdopterin synthase subunit MoaD [54287] (1 species) Species Escherichia coli [TaxId:562] [54288] (5 PDB entries) 
Domain d1jw9d_: 1jw9 D: [67378]
Other proteins in same PDB: d1jw9b_
Details for d1jw9d_
PDB Entry: 1jw9 (more details), 1.7 Å
PDB Description: Structure of the Native MoeB-MoaD Protein Complex
SCOP Domain Sequences for d1jw9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jw9d_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli}
mikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlv
sfdhpltdgdevaffppvtgg
SCOP Domain Coordinates for d1jw9d_:
Click to download the PDB-style file with coordinates for d1jw9d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jw9d_:
- d1jw9d_ first appeared in SCOP 1.59
- d1jw9d_ appears in SCOP 1.63
- d1jw9d_ appears in the current release, SCOPe 2.08
View in 3D
