SCOPe 2.08: Domain d1jw9d_: 1jw9 D:

Lineage for d1jw9d_ (1jw9 D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.3: MoaD/ThiS [54285] (5 families)
   possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.3.1: MoaD [54286] (2 proteins)
   automatically mapped to Pfam PF02597

6. Protein Molybdopterin synthase subunit MoaD [54287] (2 species)

7. Species Escherichia coli [TaxId:562] [54288] (7 PDB entries)

8. Domain d1jw9d_: 1jw9 D: [67378]
   Other proteins in same PDB: d1jw9b_
   complexed with MoeB
   complexed with so4, zn

Details for d1jw9d_

PDB Entry: 1jw9, 1.7 Å

PDB Description: Structure of the Native MoeB-MoaD Protein Complex

PDB Compounds: (D:) molybdopterin [mpt] converting factor, subunit 1

SCOPe Domain Sequences for d1jw9d_:

Sequence; same for both SEQRES and ATOM records:

>d1jw9d_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli [TaxId: 562]}
mikvlffaqvrelvgtdatevaadfptvealrqhmaaqsdrwalaledgkllaavnqtlv
sfdhpltdgdevaffppvtgg

Timeline for d1jw9d_:

• d1jw9d_ first appeared in SCOP 1.59
  
• d1jw9d_ appears in SCOPe 2.07