Lineage for d1jw4a_ (1jw4 A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.1: Phosphate binding protein-like [53851] (18 proteins) 
Protein D-maltodextrin-binding protein, MBP [53862] (3 species) Species Escherichia coli [TaxId:562] [53863] (25 PDB entries) 
Domain d1jw4a_: 1jw4 A: [67374]
Details for d1jw4a_
PDB Entry: 1jw4 (more details), 2 Å
PDB Description: structure of ligand-free maltodextrin-binding protein
SCOP Domain Sequences for d1jw4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jw4a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritk
SCOP Domain Coordinates for d1jw4a_:
Click to download the PDB-style file with coordinates for d1jw4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jw4a_:
- d1jw4a_ is new in SCOP 1.59
- d1jw4a_ appears in SCOP 1.61
- d1jw4a_ appears in the current release, SCOPe 2.08
View in 3D