Lineage for d1jw2a_ (1jw2 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987222Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 1987323Superfamily a.23.5: Hemolysin expression modulating protein HHA [68989] (2 families) (S)
    automatically mapped to Pfam PF05321
  5. 1987324Family a.23.5.1: Hemolysin expression modulating protein HHA [68990] (2 protein domains)
  6. 1987325Protein Hemolysin expression modulating protein HHA [68991] (2 species)
  7. 1987326Species Escherichia coli [TaxId:562] [68992] (1 PDB entry)
  8. 1987327Domain d1jw2a_: 1jw2 A: [67372]

Details for d1jw2a_

PDB Entry: 1jw2 (more details)

PDB Description: solution structure of hemolysin expression modulating protein hha from escherichia coli. ontario centre for structural proteomics target ec0308_1_72; northeast structural genomics target et88
PDB Compounds: (A:) HEMOLYSIN EXPRESSION MODULATING PROTEIN Hha

SCOPe Domain Sequences for d1jw2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jw2a_ a.23.5.1 (A:) Hemolysin expression modulating protein HHA {Escherichia coli [TaxId: 562]}
msekpltktdylmrlrrcqtidtlervieknkyelsdnelavfysaadhrlaeltmnkly
dkipssvwkfir

SCOPe Domain Coordinates for d1jw2a_:

Click to download the PDB-style file with coordinates for d1jw2a_.
(The format of our PDB-style files is described here.)

Timeline for d1jw2a_: