Lineage for d1jvnb2 (1jvn B:-3-229)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481897Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 481898Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (9 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 481968Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)
  7. 481969Species Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId:4932] [69449] (4 PDB entries)
  8. 481971Domain d1jvnb2: 1jvn B:-3-229 [67358]
    Other proteins in same PDB: d1jvna1, d1jvnb1

Details for d1jvnb2

PDB Entry: 1jvn (more details), 2.1 Å

PDB Description: crystal structure of imidazole glycerol phosphate synthase: a tunnel through a (beta/alpha)8 barrel joins two active sites

SCOP Domain Sequences for d1jvnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jvnb2 c.23.16.1 (B:-3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7}
gshmpvvhvidvesgnlqsltnaiehlgyevqlvkspkdfnisgtsrlilpgvgnyghfv
dnlfnrgfekpireyiesgkpimgicvglqalfagsvespkstglnyidfklsrfddsek
pvpeigwnscipsenlffgldpykryyfvhsfaailnsekkknlendgwkiakakygsee
fiaavnknnifatqfhpeksgkaglnvienflkqqsppipnysaeekellmn

SCOP Domain Coordinates for d1jvnb2:

Click to download the PDB-style file with coordinates for d1jvnb2.
(The format of our PDB-style files is described here.)

Timeline for d1jvnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jvnb1