SCOP 1.73: Domain d1jvmd_: 1jvm D:

Lineage for d1jvmd_ (1jvm D:)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)

6. Protein Potassium channel protein [56901] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (27 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916

8. Domain d1jvmd_: 1jvm D: [67354]
   complexed with TBA (tetrabutylammonium) and rubidium
   complexed with rb, tba; mutant

Details for d1jvmd_

PDB Entry: 1jvm, 2.8 Å

PDB Description: kcsa potassium channel with tba (tetrabutylammonium) and rubidium

PDB Compounds: (D:) Voltage-gated potassium channel

SCOP Domain Sequences for d1jvmd_:

Sequence; same for both SEQRES and ATOM records:

>d1jvmd_ f.14.1.1 (D:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
vtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrg

Timeline for d1jvmd_:

• d1jvmd_ first appeared in SCOP 1.59
  
• d1jvmd_ appears in SCOP 1.71
  
• d1jvmd_ appears in SCOP 1.75
  
• d1jvmd_ appears in the current release, SCOPe 2.08