SCOP 1.65: Domain d1jvma_: 1jvm A:

Lineage for d1jvma_ (1jvm A:)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (4 proteins)

6. Protein Potassium channel protein [56901] (1 species)

7. Species Streptomyces lividans [TaxId:1916] [56902] (8 PDB entries)

8. Domain d1jvma_: 1jvm A: [67351]

Details for d1jvma_

PDB Entry: 1jvm, 2.8 Å

PDB Description: kcsa potassium channel with tba (tetrabutylammonium) and rubidium

SCOP Domain Sequences for d1jvma_:

Sequence; same for both SEQRES and ATOM records:

>d1jvma_ f.14.1.1 (A:) Potassium channel protein {Streptomyces lividans}
lhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdlyp
vtlwgrcvavvvmvagitsfglvtaalatwfvgreqe

Timeline for d1jvma_:

• d1jvma_ first appeared in SCOP 1.59
  
• d1jvma_ appears in SCOP 1.63
  
• d1jvma_ appears in SCOP 1.67
  
• d1jvma_ appears in the current release, SCOPe 2.08