Lineage for d1jv5b1 (1jv5 B:306-417)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2344816Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2344820Species Engineered (including hybrid species) [88562] (68 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 2344884Domain d1jv5b1: 1jv5 B:306-417 [67345]
    Other proteins in same PDB: d1jv5a_, d1jv5b2
    part of an anti-blood group A Fv

Details for d1jv5b1

PDB Entry: 1jv5 (more details), 2.2 Å

PDB Description: anti-blood group a fv
PDB Compounds: (B:) Ig chain heavy chain precursor V region

SCOPe Domain Sequences for d1jv5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jv5b1 b.1.1.1 (B:306-417) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
qpgaelvkpgtsvklsckasgynftsywinwvklrpgqglewigdiypgsgitnynekfk
skatltvdtssstaymqlsslasedsalyycagqygnlwfaywgqgtlvtvs

SCOPe Domain Coordinates for d1jv5b1:

Click to download the PDB-style file with coordinates for d1jv5b1.
(The format of our PDB-style files is described here.)

Timeline for d1jv5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jv5b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1jv5a_