Lineage for d1jv5a_ (1jv5 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782638Species Engineered (including hybrid species) [88533] (52 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831
    SQ NA # Humanized antibody
    SQ NA # humanized antibody
    SQ NA # engineered antibody
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 782667Domain d1jv5a_: 1jv5 A: [67344]
    Other proteins in same PDB: d1jv5b_
    part of an anti-blood group A Fv

Details for d1jv5a_

PDB Entry: 1jv5 (more details), 2.2 Å

PDB Description: anti-blood group a fv
PDB Compounds: (A:) Ig kappa chain precursor V region

SCOP Domain Sequences for d1jv5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jv5a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqttsslsaslgdrvtiscrasqdinnylnwyqqkpdgtvkllihytsrlhsgvps
rfsgsgsgtdysltisnleqediatyfcqqgntlpwtfgggtkleik

SCOP Domain Coordinates for d1jv5a_:

Click to download the PDB-style file with coordinates for d1jv5a_.
(The format of our PDB-style files is described here.)

Timeline for d1jv5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jv5b_