Lineage for d1jv2b5 (1jv2 B:563-605)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258757Family g.3.11.6: Integrin beta EGF-like domains [69940] (1 protein)
  6. 2258758Protein Integrin beta EGF-like domains [69941] (1 species)
  7. 2258759Species Human (Homo sapiens) [TaxId:9606] [69942] (5 PDB entries)
    Uniprot P05106 27-716
  8. 2258765Domain d1jv2b5: 1jv2 B:563-605 [67342]
    Other proteins in same PDB: d1jv2a1, d1jv2a2, d1jv2a3, d1jv2a4, d1jv2b1, d1jv2b2, d1jv2b3
    complexed with ca, nag

Details for d1jv2b5

PDB Entry: 1jv2 (more details), 3.1 Å

PDB Description: crystal structure of the extracellular segment of integrin alphavbeta3
PDB Compounds: (B:) platelet membrane glycoprotein iiia beta subunit

SCOPe Domain Sequences for d1jv2b5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
rtdtcmssngllcsgrgkcecgscvciqpgsygdtcekcptcp

SCOPe Domain Coordinates for d1jv2b5:

Click to download the PDB-style file with coordinates for d1jv2b5.
(The format of our PDB-style files is described here.)

Timeline for d1jv2b5: