![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.200: Integrin beta tail domain [69686] (1 superfamily) alpha-beta-loop-beta(3); loop across free side of beta-sheet |
![]() | Superfamily d.200.1: Integrin beta tail domain [69687] (1 family) ![]() |
![]() | Family d.200.1.1: Integrin beta tail domain [69688] (1 protein) |
![]() | Protein Integrin beta tail domain [69689] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69690] (4 PDB entries) Uniprot P05106 27-716 |
![]() | Domain d1jv2b3: 1jv2 B:606-690 [67340] Other proteins in same PDB: d1jv2a1, d1jv2a2, d1jv2a3, d1jv2a4, d1jv2b1, d1jv2b2, d1jv2b4, d1jv2b5 complexed with ca, nag |
PDB Entry: 1jv2 (more details), 3.1 Å
SCOPe Domain Sequences for d1jv2b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jv2b3 d.200.1.1 (B:606-690) Integrin beta tail domain {Human (Homo sapiens) [TaxId: 9606]} dactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykneddcvv rfqyyedssgksilyvveepecpkg
Timeline for d1jv2b3:
![]() Domains from same chain: (mouse over for more information) d1jv2b1, d1jv2b2, d1jv2b4, d1jv2b5 |
![]() Domains from other chains: (mouse over for more information) d1jv2a1, d1jv2a2, d1jv2a3, d1jv2a4 |