Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.200: Integrin beta tail domain [69686] (1 superfamily) alpha-beta-loop-beta(3); loop across free side of beta-sheet |
Superfamily d.200.1: Integrin beta tail domain [69687] (1 family) |
Family d.200.1.1: Integrin beta tail domain [69688] (1 protein) |
Protein Integrin beta tail domain [69689] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69690] (3 PDB entries) |
Domain d1jv2b3: 1jv2 B:606-690 [67340] Other proteins in same PDB: d1jv2a1, d1jv2a2, d1jv2a3, d1jv2a4, d1jv2b1, d1jv2b2, d1jv2b4, d1jv2b5 complexed with ca, nag |
PDB Entry: 1jv2 (more details), 3.1 Å
SCOP Domain Sequences for d1jv2b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jv2b3 d.200.1.1 (B:606-690) Integrin beta tail domain {Human (Homo sapiens)} dactfkkecveckkfdrepymtentcnrycrdeiesvkelkdtgkdavnctykneddcvv rfqyyedssgksilyvveepecpkg
Timeline for d1jv2b3:
View in 3D Domains from same chain: (mouse over for more information) d1jv2b1, d1jv2b2, d1jv2b4, d1jv2b5 |
View in 3D Domains from other chains: (mouse over for more information) d1jv2a1, d1jv2a2, d1jv2a3, d1jv2a4 |