Lineage for d1jv2b2 (1jv2 B:107-354)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500013Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2500014Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2500015Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2500076Protein Integrin beta A domain [69542] (1 species)
  7. 2500077Species Human (Homo sapiens) [TaxId:9606] [69543] (9 PDB entries)
    Uniprot P05106 27-716 ! Uniprot P05106 27-466
  8. 2500087Domain d1jv2b2: 1jv2 B:107-354 [67339]
    Other proteins in same PDB: d1jv2a1, d1jv2a2, d1jv2a3, d1jv2a4, d1jv2b1, d1jv2b3, d1jv2b4, d1jv2b5
    complexed with ca, nag

Details for d1jv2b2

PDB Entry: 1jv2 (more details), 3.1 Å

PDB Description: crystal structure of the extracellular segment of integrin alphavbeta3
PDB Compounds: (B:) platelet membrane glycoprotein iiia beta subunit

SCOPe Domain Sequences for d1jv2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jv2b2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]}
vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy
isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai
mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt
mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd
aygkirsk

SCOPe Domain Coordinates for d1jv2b2:

Click to download the PDB-style file with coordinates for d1jv2b2.
(The format of our PDB-style files is described here.)

Timeline for d1jv2b2: