Lineage for d1jv2b2 (1jv2 B:107-354)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125459Fold c.62: Integrin A (or I) domain [53299] (1 superfamily)
  4. 125460Superfamily c.62.1: Integrin A (or I) domain [53300] (1 family) (S)
  5. 125461Family c.62.1.1: Integrin A (or I) domain [53301] (7 proteins)
  6. 125474Protein Integrin beta A domain [69542] (1 species)
  7. 125475Species Human (Homo sapiens) [TaxId:9606] [69543] (1 PDB entry)
  8. 125476Domain d1jv2b2: 1jv2 B:107-354 [67339]
    Other proteins in same PDB: d1jv2a1, d1jv2a2, d1jv2a3, d1jv2a4, d1jv2b1, d1jv2b3, d1jv2b4, d1jv2b5

Details for d1jv2b2

PDB Entry: 1jv2 (more details), 3.1 Å

PDB Description: crystal structure of the extracellular segment of integrin alphavbeta3

SCOP Domain Sequences for d1jv2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jv2b2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens)}
vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy
isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai
mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt
mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd
aygkirsk

SCOP Domain Coordinates for d1jv2b2:

Click to download the PDB-style file with coordinates for d1jv2b2.
(The format of our PDB-style files is described here.)

Timeline for d1jv2b2: