SCOPe 2.07: Domain d1jv2b1: 1jv2 B:55-106,B:355-434

Lineage for d1jv2b1 (1jv2 B:55-106,B:355-434)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.15: Integrin domains [69179] (2 families)

5. Family b.1.15.1: Integrin domains [69180] (2 proteins)

6. Protein Hybrid domain of integrin beta [69183] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69184] (9 PDB entries)
   Uniprot P05106 27-466

8. Domain d1jv2b1: 1jv2 B:55-106,B:355-434 [67338]
   Other proteins in same PDB: d1jv2a1, d1jv2a2, d1jv2a3, d1jv2a4, d1jv2b2, d1jv2b3, d1jv2b4, d1jv2b5
   complexed with ca, nag

Details for d1jv2b1

PDB Entry: 1jv2, 3.1 Å

PDB Description: crystal structure of the extracellular segment of integrin alphavbeta3

PDB Compounds: (B:) platelet membrane glycoprotein iiia beta subunit

SCOPe Domain Sequences for d1jv2b1:

Sequence; same for both SEQRES and ATOM records:

>d1jv2b1 b.1.15.1 (B:55-106,B:355-434) Hybrid domain of integrin beta {Human (Homo sapiens) [TaxId: 9606]}
efpvsearvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqXvelevrd
lpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvgf
kdslivqvtfdcd

Timeline for d1jv2b1:

• d1jv2b1 first appeared in SCOP 1.59
  
• d1jv2b1 appears in SCOPe 2.06
  
• d1jv2b1 appears in the current release, SCOPe 2.08