Lineage for d1jv2a2 (1jv2 A:599-737)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764933Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2764934Family b.1.15.1: Integrin domains [69180] (2 proteins)
  6. 2764948Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species)
  7. 2764949Species Human (Homo sapiens) [TaxId:9606] [69182] (4 PDB entries)
    Uniprot P06756 31-986
  8. 2764954Domain d1jv2a2: 1jv2 A:599-737 [67335]
    Other proteins in same PDB: d1jv2a4, d1jv2b1, d1jv2b2, d1jv2b3, d1jv2b4, d1jv2b5
    complexed with ca, nag

Details for d1jv2a2

PDB Entry: 1jv2 (more details), 3.1 Å

PDB Description: crystal structure of the extracellular segment of integrin alphavbeta3
PDB Compounds: (A:) integrin, alpha v

SCOPe Domain Sequences for d1jv2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jv2a2 b.1.15.1 (A:599-737) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens) [TaxId: 9606]}
dnvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvr
nnealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiq
ssnlfdkvspvvshkvdla

SCOPe Domain Coordinates for d1jv2a2:

Click to download the PDB-style file with coordinates for d1jv2a2.
(The format of our PDB-style files is described here.)

Timeline for d1jv2a2: