Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (2 families) |
Family b.1.15.1: Integrin domains [69180] (2 proteins) |
Protein Thigh, calf-1 and calf-2 domains of integrin alpha [69181] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69182] (4 PDB entries) Uniprot P06756 31-986 |
Domain d1jv2a2: 1jv2 A:599-737 [67335] Other proteins in same PDB: d1jv2a4, d1jv2b1, d1jv2b2, d1jv2b3, d1jv2b4, d1jv2b5 complexed with ca, nag |
PDB Entry: 1jv2 (more details), 3.1 Å
SCOPe Domain Sequences for d1jv2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jv2a2 b.1.15.1 (A:599-737) Thigh, calf-1 and calf-2 domains of integrin alpha {Human (Homo sapiens) [TaxId: 9606]} dnvckpklevsvdsdqkkiyigddnpltlivkaqnqgegayeaelivsiplqadfigvvr nnealarlscafktenqtrqvvcdlgnpmkagtqllaglrfsvhqqsemdtsvkfdlqiq ssnlfdkvspvvshkvdla
Timeline for d1jv2a2: