Lineage for d1jusb1 (1jus B:2-72)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 210247Superfamily a.4.1: Homeodomain-like [46689] (11 families) (S)
    consists only of helices
  5. 210478Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (2 proteins)
  6. 210479Protein Multidrug binding protein QacR [68964] (1 species)
  7. 210480Species Staphylococcus aureus [TaxId:1280] [68965] (7 PDB entries)
  8. 210490Domain d1jusb1: 1jus B:2-72 [67328]
    Other proteins in same PDB: d1jusa2, d1jusb2, d1jusd2, d1juse2

Details for d1jusb1

PDB Entry: 1jus (more details), 2.84 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to rhodamine 6g

SCOP Domain Sequences for d1jusb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jusb1 a.4.1.9 (B:2-72) Multidrug binding protein QacR {Staphylococcus aureus}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOP Domain Coordinates for d1jusb1:

Click to download the PDB-style file with coordinates for d1jusb1.
(The format of our PDB-style files is described here.)

Timeline for d1jusb1: