![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
![]() | Family a.118.9.2: VHS domain [48468] (6 proteins) |
![]() | Protein ADP-ribosylation factor binding protein Gga3 [69097] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69098] (3 PDB entries) |
![]() | Domain d1juqd1: 1juq D:1-157 [67325] Other proteins in same PDB: d1juqb2, d1juqd2 complexed with peptide from cation-dependent mannose 6-phosphate receptor |
PDB Entry: 1juq (more details), 2.2 Å
SCOPe Domain Sequences for d1juqd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1juqd1 a.118.9.2 (D:1-157) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} maeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspqew ealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviellys wtmalpeeakikdayhmlkrqgivqsdppipvdrtli
Timeline for d1juqd1:
![]() Domains from other chains: (mouse over for more information) d1juqa_, d1juqb1, d1juqb2, d1juqc_ |