Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) |
Family a.118.9.2: VHS domain [48468] (6 proteins) |
Protein ADP-ribosylation factor binding protein Gga3 [69097] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69098] (3 PDB entries) |
Domain d1juqc_: 1juq C: [67324] Other proteins in same PDB: d1juqb2, d1juqd2 complexed with peptide from cation-dependent mannose 6-phosphate receptor |
PDB Entry: 1juq (more details), 2.2 Å
SCOPe Domain Sequences for d1juqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1juqc_ a.118.9.2 (C:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} sleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspqewealqalt vleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviellyswtmalpe eakikdayhmlkrqgivqsdppipvdrtl
Timeline for d1juqc_: