SCOPe 2.07: Domain d1juqc_: 1juq C:

Lineage for d1juqc_ (1juq C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.2: VHS domain [48468] (6 proteins)

6. Protein ADP-ribosylation factor binding protein Gga3 [69097] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69098] (3 PDB entries)

8. Domain d1juqc_: 1juq C: [67324]
   Other proteins in same PDB: d1juqb2, d1juqd2
   complexed with peptide from cation-dependent mannose 6-phosphate receptor

Details for d1juqc_

PDB Entry: 1juq, 2.2 Å

PDB Description: gga3 vhs domain complexed with c-terminal peptide from cation- dependent mannose 6-phosphate receptor

PDB Compounds: (C:) ADP-ribosylation factor binding protein gga3

SCOPe Domain Sequences for d1juqc_:

Sequence; same for both SEQRES and ATOM records:

>d1juqc_ a.118.9.2 (C:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
sleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspqewealqalt
vleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviellyswtmalpe
eakikdayhmlkrqgivqsdppipvdrtl

Timeline for d1juqc_:

• d1juqc_ first appeared in SCOP 1.59
  
• d1juqc_ appears in SCOPe 2.06
  
• d1juqc_ appears in the current release, SCOPe 2.08