SCOPe 2.04: Domain d1juqa_: 1juq A:

Lineage for d1juqa_ (1juq A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.2: VHS domain [48468] (6 proteins)

6. Protein ADP-ribosylation factor binding protein Gga3 [69097] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69098] (3 PDB entries)

8. Domain d1juqa_: 1juq A: [67322]
   complexed with peptide from cation-dependent mannose 6-phosphate receptor

Details for d1juqa_

PDB Entry: 1juq, 2.2 Å

PDB Description: gga3 vhs domain complexed with c-terminal peptide from cation- dependent mannose 6-phosphate receptor

PDB Compounds: (A:) ADP-ribosylation factor binding protein gga3

SCOPe Domain Sequences for d1juqa_:

Sequence; same for both SEQRES and ATOM records:

>d1juqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
esleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspqewealqal
tvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviellyswtmalp
eeakikdayhmlkrqgivqsdppipvdrtli

Timeline for d1juqa_:

• d1juqa_ first appeared in SCOP 1.59
  
• d1juqa_ appears in SCOPe 2.03
  
• d1juqa_ appears in SCOPe 2.05
  
• d1juqa_ appears in the current release, SCOPe 2.08