Lineage for d1juqa_ (1juq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727055Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2727070Family a.118.9.2: VHS domain [48468] (6 proteins)
  6. 2727088Protein ADP-ribosylation factor binding protein Gga3 [69097] (1 species)
  7. 2727089Species Human (Homo sapiens) [TaxId:9606] [69098] (3 PDB entries)
  8. 2727098Domain d1juqa_: 1juq A: [67322]
    Other proteins in same PDB: d1juqb2, d1juqd2
    complexed with peptide from cation-dependent mannose 6-phosphate receptor

Details for d1juqa_

PDB Entry: 1juq (more details), 2.2 Å

PDB Description: gga3 vhs domain complexed with c-terminal peptide from cation- dependent mannose 6-phosphate receptor
PDB Compounds: (A:) ADP-ribosylation factor binding protein gga3

SCOPe Domain Sequences for d1juqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1juqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
esleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspqewealqal
tvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviellyswtmalp
eeakikdayhmlkrqgivqsdppipvdrtli

SCOPe Domain Coordinates for d1juqa_:

Click to download the PDB-style file with coordinates for d1juqa_.
(The format of our PDB-style files is described here.)

Timeline for d1juqa_: