Lineage for d1jupd2 (1jup D:73-187)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100882Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
  4. 100883Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 100884Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (2 proteins)
  6. 100885Protein Multidrug binding protein QacR [69107] (1 species)
  7. 100886Species Staphylococcus aureus [TaxId:1280] [69108] (6 PDB entries)
  8. 100909Domain d1jupd2: 1jup D:73-187 [67319]
    Other proteins in same PDB: d1jupa1, d1jupb1, d1jupd1, d1jupe1

Details for d1jupd2

PDB Entry: 1jup (more details), 2.95 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to malachite green
PDB Compounds: (D:)

SCOP Domain Sequences for d1jupd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jupd2 a.121.1.1 (D:73-187) Multidrug binding protein QacR {Staphylococcus aureus}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOP Domain Coordinates for d1jupd2:

Click to download the PDB-style file with coordinates for d1jupd2.
(The format of our PDB-style files is described here.)

Timeline for d1jupd2: