SCOP 1.69: Domain d1jupb2: 1jup B:73-187

Lineage for d1jupb2 (1jup B:73-187)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (9 proteins)

6. Protein Multidrug binding protein QacR [69107] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [69108] (11 PDB entries)

8. Domain d1jupb2: 1jup B:73-187 [67317]
   Other proteins in same PDB: d1jupa1, d1jupb1, d1jupd1, d1jupe1

Details for d1jupb2

PDB Entry: 1jup, 2.95 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to malachite green

SCOP Domain Sequences for d1jupb2:

Sequence; same for both SEQRES and ATOM records:

>d1jupb2 a.121.1.1 (B:73-187) Multidrug binding protein QacR {Staphylococcus aureus}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Timeline for d1jupb2:

• d1jupb2 first appeared in SCOP 1.59
  
• d1jupb2 appears in SCOP 1.67
  
• d1jupb2 appears in SCOP 1.71
  
• d1jupb2 appears in the current release, SCOPe 2.08