SCOP 1.63: Domain d1jupa2: 1jup A:73-187

Lineage for d1jupa2 (1jup A:73-187)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (2 proteins)

6. Protein Multidrug binding protein QacR [69107] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [69108] (7 PDB entries)

8. Domain d1jupa2: 1jup A:73-187 [67315]
   Other proteins in same PDB: d1jupa1, d1jupb1, d1jupd1, d1jupe1

Details for d1jupa2

PDB Entry: 1jup, 2.95 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to malachite green

SCOP Domain Sequences for d1jupa2:

Sequence; same for both SEQRES and ATOM records:

>d1jupa2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Timeline for d1jupa2:

• d1jupa2 first appeared in SCOP 1.59
  
• d1jupa2 appears in SCOP 1.61
  
• d1jupa2 appears in SCOP 1.65
  
• d1jupa2 appears in the current release, SCOPe 2.08