Lineage for d1jupa2 (1jup A:73-187)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156164Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
  4. 156165Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 156166Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (2 proteins)
  6. 156167Protein Multidrug binding protein QacR [69107] (1 species)
  7. 156168Species Staphylococcus aureus [TaxId:1280] [69108] (7 PDB entries)
  8. 156189Domain d1jupa2: 1jup A:73-187 [67315]
    Other proteins in same PDB: d1jupa1, d1jupb1, d1jupd1, d1jupe1

Details for d1jupa2

PDB Entry: 1jup (more details), 2.95 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to malachite green

SCOP Domain Sequences for d1jupa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jupa2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOP Domain Coordinates for d1jupa2:

Click to download the PDB-style file with coordinates for d1jupa2.
(The format of our PDB-style files is described here.)

Timeline for d1jupa2: