Lineage for d1juob_ (1juo B:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) Fold a.39: EF Hand-like [47472] (4 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.8: Penta-EF-hand proteins [63550] (2 proteins) Protein Sorcin [69023] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69024] (1 PDB entry) 
Domain d1juob_: 1juo B: [67313]
Details for d1juob_
PDB Entry: 1juo (more details), 2.2 Å
PDB Description: Crystal Structure of Calcium-free Human Sorcin: A Member of the Penta-EF-Hand Protein Family
SCOP Domain Sequences for d1juob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1juob_ a.39.1.8 (B:) Sorcin {Human (Homo sapiens)}
fpgqtqdplygyfaavagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdm
sgtmgfnefkelwavlngwrqhfisfdtdrsgtvdpqelqkalttmgfrlspqavnsiak
rystngkitfddyiaccvklraltdsfrrrdtaqqgvvnfpyddfiqcvmsv
SCOP Domain Coordinates for d1juob_:
Click to download the PDB-style file with coordinates for d1juob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1juob_:
- d1juob_ is new in SCOP 1.59
- d1juob_ appears in SCOP 1.61
- d1juob_ appears in the current release, SCOPe 2.08
View in 3D
